SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A081XRE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A081XRE6
Domain Number 1 Region: 115-261
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-18
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A081XRE6
Sequence length 291
Comment (tr|A0A081XRE6|A0A081XRE6_STRTO) Cell wall assembly protein Knr4 {ECO:0000313|EMBL:KES06119.1} KW=Complete proteome; Reference proteome OX=55952 OS=Streptomyces toyocaensis. GN=BU52_15395 OC=Streptomyces.
Sequence
MDERGYPDFSPYARAAVEIAEPPEGFGVDELRLTDYVSANAALAASGHELWDTVPAVATP
HGWTWHHVVGTRRLELVPVEVKALLRHHGGVATSAVDHGKRGTRPLQETRPAHFGLPKSG
VAVTESQVLGVEEDLGYRLPGAYRSFLKAAGGCAPVGTALDAELGLLVDQPFFTVRDEAA
VNDLVYVNKCLRDHLTKDYLCVAFVQGGLLAVKVRGERQGSVWFCAYDDARDVDPSWPPA
ERVERLLLACGDDFDAFLARLAGSPPELETVANLMVDGGFARAVPVSSAGE
Download sequence
Identical sequences A0A081XRE6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]