SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A083ZVV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A083ZVV5
Domain Number - Region: 21-88
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000379
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A083ZVV5
Sequence length 179
Comment (tr|A0A083ZVV5|A0A083ZVV5_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KEY57184.1} KW=Complete proteome; Reference proteome OX=1410619 OS=Serratia sp. DD3. GN=SRDD_38550 OC=Yersiniaceae; Serratia.
Sequence
MSSEQFCNEMIKIAKTVSRDEFDLVISRPPSQESTDLVEKTTGIKIPGNFLAFSQKYNGL
SIFAKEEIWPEPEFIEVRQAWEFQSGVILLGIEAEQLPEWANIMSIYDEFVERFGIKDIL
PLLRVYGRKGHFWGARKDGAFVEVDGDEVTIENKAFIEVYSEQIQSLIERTHEWMARKK
Download sequence
Identical sequences A0A083ZVV5
WP_023492744.1.64195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]