SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084ALX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084ALX6
Domain Number 1 Region: 346-458,521-544
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000746
Family Regulator of G-protein signaling, RGS 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084ALX6
Sequence length 558
Comment (tr|A0A084ALX6|A0A084ALX6_STACB) Uncharacterized protein {ECO:0000313|EMBL:KEY66305.1} KW=Complete proteome OX=1280523 OS=mold) (Stilbospora chartarum). GN=S7711_02767 OC=Stachybotrys.
Sequence
MSDPAPQLGLDAVGIFYMAFGCCWTVVLIAGMTYLWTKRHMPLLRIRGLPLSFSAIIFLH
LYWMAVQFGYVYGSFMSAGVEFWIMGIWLPFGVALFHASNTRFLYVARAQRRFVEKVPES
DRATIRPRPETLLGKYRAMDHTRRVLLLVGSGMLFQFLLTLVMFLVSRKFHPSFGIPGTE
VTGTPAEQRADAGRGWEWWPSVFWQFFWAWLVAPFILWKARKLNDTQGWRTQTIACCIAN
LHATPMWLVGLYIPEMATVNRYWIPPQWIAVSIMLIEIFTIFIPCWEVMKHRNLCQETLE
SIAHWESRQRTSAENGIKSLHSSSTVSSWLSRMSGRTSSTKSSNSSGSSVLTMDALELTL
ARNPEPLQTFSALKDFSGENIAFLMRVREWKVKYLGEGRDTKYSQKEAPACVLSRECFES
AVRIYHDFVSARGAEFQINLSSTDFRKLESIFEAAASAMYRDHPDIDPVTPFNTQPHGLP
RCHNGSDVAIMEDAGARDMIELASQASQFGVDVPEGFDETVFDDAEGSIKYLVLTNTWPK
FIKERRSIDLMERLASGV
Download sequence
Identical sequences A0A084ALX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]