SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084B7J6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084B7J6
Domain Number 1 Region: 5-143
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 9.52e-36
Family Cofilin-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084B7J6
Sequence length 146
Comment (tr|A0A084B7J6|A0A084B7J6_STACB) Uncharacterized protein {ECO:0000313|EMBL:KEY73525.1} KW=Complete proteome OX=1280523 OS=mold) (Stilbospora chartarum). GN=S7711_03690 OC=Stachybotrys.
Sequence
MSGLDAPEIAAAYDAVRSDKDSTNWLLISYASAVGNKLSLTQTGTGGLPELAAALDDSQV
QYGYARVEYANDAESTRVKFALIVWIGESTKVMRKARVSVESGDVKRVLAHHSIAVTTGD
KAELAEKEVVARLRKAGGADYNGGRG
Download sequence
Identical sequences A0A084B7J6 A0A084RWU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]