SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084BCH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084BCH8
Domain Number 1 Region: 15-67,169-250
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.89e-23
Family Regulator of G-protein signaling, RGS 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084BCH8
Sequence length 365
Comment (tr|A0A084BCH8|A0A084BCH8_STACB) Uncharacterized protein {ECO:0000313|EMBL:KEY75257.1} KW=Complete proteome OX=1280523 OS=mold) (Stilbospora chartarum). GN=S7711_07611 OC=Stachybotrys.
Sequence
MAEHQPAPTVPSMSPQPDMTRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLDF
WLDVAQHMSLCRHYVRELRRSVLIGTPDQDKTGSKRSSQILENMGDLESRPAGPSMYATE
KERDQDAQMSAFLREEMHDSPHSGSGRIRPSPQFSNSHDLTTDSNSPAHTVARQDIRASA
EKILYTFLLPGAEREITLPGSITQDVTISIEELGRDDPEVFDVAKDYVFQAMERDAFPGF
LRMKALGNLIPPTLIVRLTVGLVAMFGGFWAAFVLIFLDMSRTTRCWLILPFTVGVYLLA
SYQYSLDPVMALIGYSEYTPFNFSRIREPYVRKLLAKRAIMVLAVTFLVDAGLCLLFILV
PGRRL
Download sequence
Identical sequences A0A084BCH8 A0A084RPA1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]