SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084C968 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084C968
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.72e-46
Family SMI1/KNR4-like 0.000000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084C968
Sequence length 135
Comment (tr|A0A084C968|A0A084C968_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:KEY86347.1} KW=Complete proteome OX=1495066 OS=Pseudomonas capeferrum. GN=PC358_21535 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEVIEQLREANEPVPVPLELPDEDQLVEVEEQLFINIPFVFKEFLLTVSDVVYGSLEPV
TITDPQSHTYLPDVASNAWDAGVPRDLIPICQDGDNYYCVEEDGTVVLWDAEDEIVGEDS
WESVWHWARDVWLES
Download sequence
Identical sequences A0A084C968 A0A099E6S7
WP_033702408.1.25404 WP_033702408.1.75421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]