SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084D6V7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084D6V7
Domain Number 1 Region: 3-122
Classification Level Classification E-value
Superfamily CobE/GbiG C-terminal domain-like 3.79e-25
Family CobE/GbiG C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084D6V7
Sequence length 125
Comment (tr|A0A084D6V7|A0A084D6V7_9BURK) Cobalamin biosynthesis protein CbiG {ECO:0000313|EMBL:KEZ01449.1} KW=Complete proteome OX=1506588 OS=Burkholderia sp. MSh2. GN=GQ57_35195 OC=Burkholderiaceae; Burkholderia.
Sequence
MMRVALGVGFRAGATAAQLDAAIRAALARYPDAEPALVATLADKARARALRTVCARRGWP
LVAFDAALLASRPELAASGASNAALARFGVAGVAEPCARLAAPHGRLLGPKLIRDGVTVA
LAGPL
Download sequence
Identical sequences A0A084D6V7
WP_031398679.1.15273 WP_031398679.1.40489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]