SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084EXC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084EXC5
Domain Number 1 Region: 35-117
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000968
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084EXC5
Sequence length 120
Comment (tr|A0A084EXC5|A0A084EXC5_HAEPR) Uncharacterized protein {ECO:0000313|EMBL:KEZ22617.1} KW=Complete proteome OX=738 OS=Haemophilus parasuis. GN=HS327_01073 OC=Pasteurellaceae; Haemophilus.
Sequence
MRNTFRVYSPYALDGFIYPSKYLELSNDLTEISKIPFFSWWFEDCDDSELEIYTQALEHF
TGIKNLISFARDGDWAACFNLLDRSGDPKVYVYDLGNRNNHYEVKNFEEWLKLVISEAQK
Download sequence
Identical sequences A0A084EXC5
WP_042905859.1.24576 WP_042905859.1.2841 WP_042905859.1.52693 WP_042905859.1.9321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]