SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084FX63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084FX63
Domain Number 1 Region: 137-222,287-354
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.06e-18
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084FX63
Sequence length 532
Comment (tr|A0A084FX63|A0A084FX63_9PEZI) Glucan synthesis regulatory protein {ECO:0000313|EMBL:KEZ39675.1} KW=Complete proteome; Reference proteome OX=563466 OS=Scedosporium apiospermum. GN=SAPIO_CDS9617 OC=Scedosporium.
Sequence
MASFGAALRSFWHTMTSNDRHSTFDSPYRTGRHVPLEGRNGMLTSVATASESRADINAPY
RDDGTRSSDFNAPISPYTPTNTSSGHYSPGLRSSSAQRLSQSNDGFEVQGQAAGDVQMQS
FQDGLPPPPPVTHTWRRIDAWAEDNYPELFDQLGEGATQNDLNELEHILDCSLPQDVRES
LMVHDGQERLGMPTGIIFSSMLLDCEEIVQEWENWRKVTSEILDDAAALRSPIPAKPTVN
GASSSSNEASSSRSHSSPRNSGSWRQDLMARQSSIPPNAIQKTYAHPAWIPLVRDWGGNN
IAVDLAPGPAGNWGQVILFGRDYDTKYVVARSWAAFLAVVADDMSSGRWFVDEDTNELKL
KEFKQARVEPSYFEILRWRMDQKHGRRAAAVAAKRKSMAPGRGSPTAPGSPTSSPYASPT
DPNAAQRGRSMQRLSSHSPLTSPKPGAYGKSSPLARVNEESLAPIVTTDLKPPKLVEVDT
PRPSEDDPSTKATDPKNGDSAQGKGKENEAPGAKLNGKLPDVNDGAMRTIEI
Download sequence
Identical sequences A0A084FX63
XP_016639474.1.67517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]