SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084FZI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084FZI9
Domain Number 1 Region: 288-384
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000349
Family Flavin-binding PAS domain 0.001
Further Details:      
 
Domain Number 2 Region: 145-259
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000252
Family Regulator of G-protein signaling, RGS 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084FZI9
Sequence length 657
Comment (tr|A0A084FZI9|A0A084FZI9_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEZ40501.1} KW=Complete proteome; Reference proteome OX=563466 OS=Scedosporium apiospermum. GN=SAPIO_CDS8394 OC=Scedosporium.
Sequence
MPTVATPITPPYDDYGRRRSSAALPTPENFDVTTTSKPRPPIILSPPPTPKAASIRKNNA
ARLSQRLRSNSGLSHHTNEDALRQYTDYNPDGSPRSPRSPLFAPVNWQGGSSGEKLSRKG
YRRSLLADYGAPESALPIPDYFGQEVFHMVMNNPSAAHRLLKYAQMKGCGENMGYLLKVQ
EYSRSVDQLTTLLATISTNFTMVSAASPIHLPGPLSKSLNTDIKHVTGSILPGLENLFLE
SKTCIEQRLVRDVYPSFVKHQLSLATSRALVSDKCLREAEFPGLGGAFCITDVALEGAPI
EFVSDEFLRLTGRRREQVLHRNTSFLQGPLTDLAGVFRIREVLSRDEECIELLINHLDDG
TPFWNFSYICPIPAPGGKVRYYLHGYINVSNCIRNSDDIIQIINSNPVPSDTASERSVER
RGPYDRRGSTSQESDYEGARGRGENVSRSKSTRKPFFRSFRKNSETSTSSQQTQNQQLQR
PDTAYSTINGNQVDGALPPLTENLVSDPPRGLPSTPYSRFILLKNTPGFTSPKLAITFAT
QAALDLLNLGLAAEAIHNKDIFTVLAEQANCVSITKAFRTSVRETVLLDGRQAVADIRVA
APAAPRKGNLMGGLGWGSEDQGSVAGARRTVLSTFWTPLKDGEGKPAWVMLVLLPSL
Download sequence
Identical sequences A0A084FZI9
XP_016640300.1.67517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]