SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084G4X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084G4X8
Domain Number 1 Region: 41-88,192-263
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.53e-17
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084G4X8
Sequence length 423
Comment (tr|A0A084G4X8|A0A084G4X8_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEZ42390.1} KW=Complete proteome; Reference proteome OX=563466 OS=Scedosporium apiospermum. GN=SAPIO_CDS5571 OC=Scedosporium.
Sequence
MRLPSWLVWYKKPEYRDIREYSTAVGTGRRPISPDGRGKTAIPSRLSLEKVLANETCSPM
SLYDFYMYLKHIEYSPENLEFYVWFKNYESRFVKPKQAGTGSLKEKDTQSLLATTVTETE
VERVSSENGADLSYDPELAKETLGQIELLIGSAAMCTMNGCNNKPTITDRVKAFAANVTG
NAGTSSGNSSSTNLAEADHRAEITAIVGLFLVPGAEKELNIPPAMRELALNQLLHSTDPE
HLRPVADHVYLLLRNCSHRNFVRLGVSNGTYETVCVATGLGIVLTCAGFLYMLVRGLAPH
IGKHSQWDAFGAWPMWWLGMTLILSGLRGSCFFLLLFTRRQPLPWERFDDSASMISQRSA
IVKRLSRLMIFDRKFRVKDASLRQLQHKIVIQSMIGGAIFATLSTLVFLFLPMWKQTVDG
YAG
Download sequence
Identical sequences A0A084G4X8
XP_016642189.1.67517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]