SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084GED1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084GED1
Domain Number 1 Region: 49-97
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000000235
Family Hevein-like agglutinin (lectin) domain 0.018
Further Details:      
 
Domain Number 2 Region: 216-259
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.00000000195
Family Hevein-like agglutinin (lectin) domain 0.04
Further Details:      
 
Domain Number 3 Region: 276-317
Classification Level Classification E-value
Superfamily Plant lectins/antimicrobial peptides 0.000000292
Family Hevein-like agglutinin (lectin) domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084GED1
Sequence length 320
Comment (tr|A0A084GED1|A0A084GED1_9PEZI) Uncharacterized protein {ECO:0000313|EMBL:KEZ45693.1} KW=Complete proteome; Reference proteome OX=563466 OS=Scedosporium apiospermum. GN=SAPIO_CDS1465 OC=Scedosporium.
Sequence
MRWATITATATLCLTGALASVGKIDGGLHVRFASDSKAALFGRQAVDNLCGPDNDNAKCS
GQRCCSMYGYCGEGREYCNRFSCQPDFGWCEGQPIPPPEPTTTAEPTSSAEPTSATSVES
SEPPAYSTSASAPPASSSALPSSSSAPSASSTSAPEPSASSTSAAASSTSASEPPASTTE
ATAEPTTSETEGTPTGSSPATGETGVPELTISESGMCGNATTCAGSTFGNCCSEFYFCGS
GEAYCGQGCREGFGNCEQEAPGTPETPTLEISTNGMCGNGTTCAGSTFGGCCSFYWFCGS
GADYCTGACRSEFGECQGAA
Download sequence
Identical sequences A0A084GED1
XP_016645492.1.67517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]