SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084GK40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084GK40
Domain Number 1 Region: 31-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000123
Family SMI1/KNR4-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084GK40
Sequence length 162
Comment (tr|A0A084GK40|A0A084GK40_BACID) Uncharacterized protein {ECO:0000313|EMBL:KEZ47702.1} KW=Complete proteome; Reference proteome OX=246786 OS=Bacillus indicus. GN=GS18_0218745 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIIETLESLKANLDGDGRFRIHLNDGTAADKKCLFFEPASLQEINEFKFDLPDDYKTFLT
LHNGGRIFTDDWGSGIFVHSLKEIIQETLSISHLIPEKYFCVIRYADVGYFLIDEQKVER
GEKDYLLYEDIDTSNPPQNLKMTFEEFIEKLIKFEGELFWLK
Download sequence
Identical sequences A0A084GK40
WP_029566325.1.15822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]