SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084IZS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084IZS5
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.24e-20
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084IZS5
Sequence length 216
Comment (tr|A0A084IZS5|A0A084IZS5_BACMY) SMI1/KNR4 family protein {ECO:0000313|EMBL:PGA15241.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=COL71_06170 OC=Bacillus cereus group.
Sequence
MDYELLKERIEIITSRIKEIGGEVQEVCIDEPSSLEKIIQVEKKLGVKLPNSFKKVLLEF
SGNFSLRWFLPDDMELPNEFREIFCGTPHWSLESLSEFEKERKDWIDTVFPNPEDEYDIV
WHNKLAFCEVGNGDYLAFDMQDNIDAPIIYLSHEDGEGHGYKIANNFIEFIDNWSRIAFV
GCEDWQWLPFTTSLESGVNPDDEPAKKFRNWLGLNI
Download sequence
Identical sequences A0A084IZS5
WP_033728062.1.27732 WP_033728062.1.37635 WP_033728062.1.46157 WP_033728062.1.47674 WP_033728062.1.60236 WP_033728062.1.75292 WP_033728062.1.82832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]