SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084J1C9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084J1C9
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.24e-23
Family SMI1/KNR4-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084J1C9
Sequence length 143
Comment (tr|A0A084J1C9|A0A084J1C9_BACMY) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AJH18413.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=BG05_2986 OC=Bacillus cereus group.
Sequence
MWKNTIRSISANLSLKNPATKDELAEVQKNLQLELPNDLYQLLQETNGIEGEYGQFIWDA
SKIKIENMNMRNIIDFKDLYMPFDCLLFFADGGNGDLFGYSILNGIVQRDDIYVWNHEND
SRTWVAPSLKIFMVWWESGKITI
Download sequence
Identical sequences A0A084J1C9 A0A1I6CEQ0
WP_003190159.1.20051 WP_003190159.1.20881 WP_003190159.1.68186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]