SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084J277 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084J277
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 4.58e-87
Family Hypothetical protein YwqG 0.000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084J277
Sequence length 271
Comment (tr|A0A084J277|A0A084J277_BACMY) DUF1963 domain-containing protein {ECO:0000313|EMBL:PGA12537.1} KW=Complete proteome OX=1405 OS=Bacillus mycoides. GN=BLX04_25110 OC=Bacillus cereus group.
Sequence
MKNTYQLQIPKELEQYRSILEESVKPYIKASGTLAETTLFESKFGGYPYLPIDQEHPKDS
NGQPMMLLAQLNFEEMPHVEYMPQKGMLQFFVSAEDELYGADFDHPTIQKDFRIIYHSTI
IEDLNKVITDFSYLNTSELEDFIIPEAAKLKFELGYQPVTSRDYRFEKMFSEEIDWEEIV
DEENNTELGELYDDLCKDQGHKIGGYPFFTQTDPREWEEKYQQHDILLLQIDTDDSLNIM
WGDSGVANFFIKKDDLLNLDFSNVIYNWDCY
Download sequence
Identical sequences A0A084J277 A0A1S9TU91 R8N2S5
WP_016120278.1.11324 WP_016120278.1.21695 WP_016120278.1.38645 WP_016120278.1.39896 WP_016120278.1.60236 WP_016120278.1.63476 WP_016120278.1.93582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]