SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084JPT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084JPT2
Domain Number 1 Region: 142-276
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.28e-37
Family AadK C-terminal domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.11e-23
Family AadK N-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084JPT2
Sequence length 281
Comment (tr|A0A084JPT2|A0A084JPT2_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KEZ90966.1} KW=Complete proteome; Reference proteome OX=29354 OS=[Clostridium] celerecrescens. GN=IO98_06205 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MNRYENIINNFVLWGNKSDGLYEAMIIGSWTRNDHPADEFSDLDLVMIVDNPDIFLQSNQ
WLEQIGYFHISFIENTIGGAKERRILFDDALDVDFVILSKSQLEDAVKSGEIGILKSGYR
ILIDKIGIEHTLPPLSAENSLYVLLSEHDFSNVVNDFWYHAIWTAKKLMRGELWTAKSCV
DNYMMWKLLTMIECHAHVLNGLKYNTWHNGRFIEEWAEDWIIQKLSDCYAHYEKNDVKNS
LLATMDLFRSISVVIAEKLNYKYPAEADNYSTDWVIKALSV
Download sequence
Identical sequences A0A084JPT2
WP_038279075.1.26132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]