SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084JR14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084JR14
Domain Number 1 Region: 152-255
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.06e-26
Family NlpC/P60 0.0023
Further Details:      
 
Domain Number 2 Region: 89-130
Classification Level Classification E-value
Superfamily SH3-domain 0.0000919
Family SH3-domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084JR14
Sequence length 280
Comment (tr|A0A084JR14|A0A084JR14_9FIRM) Hydrolase Nlp/P60 {ECO:0000313|EMBL:KEZ91398.1} KW=Complete proteome; Reference proteome OX=29354 OS=[Clostridium] celerecrescens. GN=IO98_02980 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MKENSLGETVSAISDEGLYGMGLAITGPNERGFYPVRTFYGYSGFIRKEEIELVSLDELK
CWEESELMVTDGIYVDILSLPKVQGVRLLSLFRGSLIKVLSFDSENEGWAKVELLDGRVG
YMRNQFLRKKEFSQCGLWTGELPQKEIVDEAHFRKSVVETAKQYLGTQYRWGGRSTAGID
CSGLTSESYLLNGILIYRDARIEPGFPVHEIPKDEMLPGDLMYFPGHIAMYMGNGSYIHS
TGKIGSGGVVINSLNPQAEDYRADLAESWYASGSIFGTVG
Download sequence
Identical sequences A0A084JR14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]