SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084QDP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084QDP9
Domain Number 1 Region: 16-68,170-251
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-23
Family Regulator of G-protein signaling, RGS 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084QDP9
Sequence length 366
Comment (tr|A0A084QDP9|A0A084QDP9_STAC4) Uncharacterized protein {ECO:0000313|EMBL:KFA62084.1} KW=Complete proteome; Reference proteome OX=1283841 OS=Stachybotrys chlorohalonata (strain IBT 40285). GN=S40285_06782 OC=Stachybotrys.
Sequence
MMAEHQPAPTVPSMSPQPDMTRNRLPTLFEVLSRRTLPPVDLFSFYIYMRDQQRSVDYLD
FWLDVAQHMSLCRHYVRELRRSVLIGTPDQDKAASKRSSQILENMGDLESRPAGPSMYAT
EKERDQDAQMSAFLREEMHDSPHSGSGRIRPSPQFSNSHDLTTDSNSPAHTVARQDIRAS
AEKILYTFLLPGAEREITLPGSITQDVTISIEELGRDDPEVFDVAKDYVFQAMERDAFPG
FLRMKALGNLIPPTLIVRLTIGLVAMFGGFWAAFVLIFLDMSRTTRCWLILPFTVGVYLL
ASYQYSLDPVMALVGYSEYTPFNFSRIREPYVRKLLAKRAIMVLAVTILVDAALCLLFIL
VPGRRL
Download sequence
Identical sequences A0A084QDP9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]