SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084QDY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084QDY5
Domain Number 1 Region: 138-225,289-356
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.26e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084QDY5
Sequence length 532
Comment (tr|A0A084QDY5|A0A084QDY5_STAC4) Uncharacterized protein {ECO:0000313|EMBL:KFA62170.1} KW=Complete proteome; Reference proteome OX=1283841 OS=Stachybotrys chlorohalonata (strain IBT 40285). GN=S40285_01713 OC=Stachybotrys.
Sequence
MANSLGSAFRAFWHTMTSNDRHSSFDSPHRTGRHVPLNGGRNGVFTGVATASDSRADITS
PFTDESGRASPNGMSPPPALSPFIPNSPRHEPYSPGLRSVAANNSSQPDGFEIQSPGDVQ
MQSFQDGLPPPPPVSHSWKRIDTWAEDNYPELFDQLCDGATANDLNDLEHQLDCSLPQDV
RQSLMVHDGQERGGTPTGIIFGSMLLDCEEIVQEWDTWRRVNHQFLLDAPVAKPSAPSRA
FGGSSSEASSSRQRPSSSSSSNPGEWRQNLLAKQDSVPPHTIQRAYAHPAWIPLVRDWGG
NNLAVDLAPGPKGQWGQVILFGRDYDTKYVVARSWGAFLAVVADDLNSGKWYVDEDNNEL
KLREFKDTRVEPSYFNILRWRMDQKYGRKAAQRKSMAPSKPVSPIGSRSASPYTEPSGDI
RGRSLQRPNGSSPLVSPMRPPYGRVLPLGMVTEETPIPPELASANIEPTKLVEVESPRVS
EDNKAAPSTTTTVTTMAPSETDLLPHKGDEPPKLNGKQPGVIEDGGMKTIEI
Download sequence
Identical sequences A0A084QDY5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]