SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084QXJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084QXJ0
Domain Number 1 Region: 183-251
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000085
Family SNARE fusion complex 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084QXJ0
Sequence length 282
Comment (tr|A0A084QXJ0|A0A084QXJ0_STAC4) Uncharacterized protein {ECO:0000313|EMBL:KFA68675.1} KW=Complete proteome; Reference proteome OX=1283841 OS=Stachybotrys chlorohalonata (strain IBT 40285). GN=S40285_02618 OC=Stachybotrys.
Sequence
MASTGNTVPQDPTNTEEGFAEEKGKGKALTEQVHEDTAMDEDDDDDDDDEEDEEEIAEAE
DEEGLEEIDLNNIVEGGRRTRGQVIDFAKAAEENPADDDEDEDDDDFQPPDDDTKIFGAS
SLHQRDPRSDLFKGYSGADQSRRGPSTSPGGQGGGYGYGGYSQSNGSLGVDNKSFRPATP
NRRGQYSDAVLNELESQNDAQVEGILGKVKTLKDMTIAIGDEIRESSALAEKMNDTFDQT
RLRLRGTMNRMLVMAQKTGISWKVWLAFFAAVSLLFIYVWLF
Download sequence
Identical sequences A0A084QXJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]