SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RJ73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RJ73
Domain Number 1 Region: 861-989
Classification Level Classification E-value
Superfamily PX domain 2.62e-24
Family PX domain 0.00093
Further Details:      
 
Domain Number 2 Region: 416-560
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-22
Family Regulator of G-protein signaling, RGS 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084RJ73
Sequence length 1227
Comment (tr|A0A084RJ73|A0A084RJ73_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA76258.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_03621 OC=Stachybotrys.
Sequence
MALKRRDVILSGLAAFIAWGYAVSWFPVLRWAGYALVAGVVISLLGVLAAIALNSRRPRV
RPSRPHGVKFLGARQWRAEVDALHQRQAYTRTPLDVDSPRVSAAVDDLLDLILRDFVNSW
YSHISKNPDFTNEVDSALRIALSSLRDALRDKDLAELFTSRLVPVITSHLRDFCEAEKAV
RGKKLNRSITESEELDLAIASKFRDGRLHPAASLSFPDTNMVQQDYLRILVARILPRILP
DRITSSRSVSIIIREIVGCAVLFPVVQLLADPDTWNQVMENFGRSMLQDRSTVRKLRAAL
DQHAPSAPRSGKLTVTPRISPGDSERKFEKFIRAIRKVNNLSDARRFRSEVASQLKRDSL
QHNSDQVYLRRLEMGKRLLDQKVNQLAAGGDRRDLHVAPVSSALPAVASSTSRLEKANLV
ELLRDPSGLSYFMEYMDRQHLMSLVQFWLVVDGFRNPLEDDGQEDERIPSKPPMWTDSDR
LDLQQIAQAYLSKPELKVPASSKRDVQEFLQSGRSATPEQYHKARRAVLKAQSAVAEEMQ
TRYFHNFKKSDLFYKCLAAEEAAHTRLRQSPVPSGHPPPPAAPTPKVTSQPFPNKPRPVA
RLAATPSLGPAVKRGGSLTDLRSLSVQGTVADGARRSFETQAPNPLFDDDDVDAEGMVDS
VQSLDQDNNATQAPDKQVVQAIEKALINIMEDDRPQTAEDLRASLFPNGEDIGSSIFSDN
DNRSAKGSIDSGRPVPAGKDMDKPSLSSLGLVSAASRIGVFVDDDLFGDEDKYLPDDGAD
ADEQRQTEDEEEVHAAAPGDLGLAEAIAALTNDIDRLVTQEAVVDSLTRKADLTNNMAEL
RILRKSKASLQREIRRKELQRQQYVVQESDNSLYGRSTIKIKSIQVGREEDGREFALYVI
EVQRNAGEQMPAASWIVTRRYSEFLDLHHKLRSRYPSVRNLDFPRRRMVMKFQSEFLRKR
QQALEHYLRELLLLPDVCRSRDLRSFLSQSIVAQGQEIVDRDDRKDIMTRFYDSVTDGVE
DILGNIPVLDQISVAGQNLIAAATSQLNAMPISVNEETFPAAEAEAELNAFESKELEPFI
KPICDIFLEVFELNKGNNWLRGRAVVMVLQQLLGGTIERKVRDNVKMLVQEDFVLRCVGL
VRDSLWPGGQLNRNRQPRNAAERNKTRTEASLMLATLVPDLAGSVVGRVNAQAASRRIFA
TLNNSRLNAHLVFTMLDEIVAILFDET
Download sequence
Identical sequences A0A084RJ73

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]