SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RJ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RJ74
Domain Number 1 Region: 28-190
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 3.14e-28
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.00046
Further Details:      
 
Domain Number 2 Region: 391-499
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000314
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084RJ74
Sequence length 591
Comment (tr|A0A084RJ74|A0A084RJ74_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA76259.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_03606 OC=Stachybotrys.
Sequence
MAQRTPTLPRLNPSPSLCSSLSETPTRTRKLRLLVAATGPRDTSWAQALVVRLSKNPQIE
TKAIVDDVVPRLAQTIIVMQNCSLAFGQGDRADDVEFYRQQAFELVEWADLMVCVPLDAD
GISKMLAGISDSLLTEVLRGWDTQKRIIMVPGMTTHIWSNPTTKRQLSKLHRKWPWIRVM
SPILWHYEGIHNPKRVPSWNGFNEILSIIKNQADLLGLGQDVEIATGMTTIVSTSDAKIQ
SKLPPEIWTLILEYAGDWEMAKALGIFTNLPMPSQWSLHPKDPANQLKVYEHELEWTVLT
CNSSAICKKLSQSPPNFQDIPALVVKLVIRFALIDVLAYMEANRPDLFKAFDGTTLPTKA
SAYYPRTDVLDYWKQSRWFRERHIYDAEAVDGASKNGHVHVLDWWWRRSGLPMRYTETAL
EQASGKGHLLVLEWWRDAAAQDENIVLRPGRSLLWATQHGQADVLRWWDASGIPVAHGDG
VAKMASRWGRVEVLETWRRLKGDDKLVFDGEVLVAPTIHQRVDVLEWWRKFAHGELEGME
GRKQPVEFRTCYIEEALEDSIGDQSKVRKWWAQNGLNLGLRNEDWLKSRYL
Download sequence
Identical sequences A0A084AZM3 A0A084RJ74

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]