SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RNZ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RNZ0
Domain Number 1 Region: 559-710
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.68e-29
Family Regulator of G-protein signaling, RGS 0.0009
Further Details:      
 
Domain Number 2 Region: 420-532
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.25e-26
Family DEP domain 0.0097
Further Details:      
 
Domain Number 3 Region: 245-371
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000365
Family PadR-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084RNZ0
Sequence length 731
Comment (tr|A0A084RNZ0|A0A084RNZ0_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA77925.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_02516 OC=Stachybotrys.
Sequence
MAALPQPTASHSLSSSTQPGQPLPAPNALPSPSPSPPAAARYFSPGTGVGSGSGTPRSSL
SDRSPERPPPALRSYNYSHNHNQNHNQTHAGAPPVGSPRIQRTPSGILSLAAAALDRTQN
AIANFSDPVIRHRRSNTALSRLSFIASPYSSPGSDSVQSTNSNSTVDRRTPNSTPSLQRS
PSPSLAVEPKPPLLGPSTRDPPSQPYTETEPNRRPPIKLPVLSPENKMHQTSSRLLRMTD
DDRPFTKDFKDLFSTLVVSLLPLTPHRVRLTKVDHTFLSEDAINNLGSLKFSQSNRMPDP
KDPSRIVTTTTTTTFSMAKDMARSICQRFVEARFIESADGKYQQIYNMKGSVWQLTPKGI
TVLDRFCSKNGIQQKQVTELANNHASQLVILERDLQTDKLLNDQGTIEVIFRRFVGTSGR
NIKSSVNAADSESLHDYKDGLTGVKMAAERKIGGKTIRDTFTGRAATDWLMDCSTIVDRR
ETIEVATLFVDYDLMEPVTQDRQYMAQNPGSTIFQPTKHAIYQLTQRGKDLINGTTSRGR
ASESEGGASSQRNGVGRDSHTQRLDKILNDPALRLLFRENLRDTHCEENLSFYQDVDEFV
RGCKSAIRVAQKNPSATSMDGVKEIMAQAYSIYNAFLAPGSPCELNIDHQLRNNLATRMT
KAVGQDVAMIETLQEVTSLFEDAQHAVFKLMASDSVPKFLRNAKYEHQLRNYEFELNGRA
LERSVSRSKRK
Download sequence
Identical sequences A0A084RNZ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]