SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RWN6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RWN6
Domain Number 1 Region: 100-281
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 4.05e-29
Family CRAL/TRIO domain 0.00079
Further Details:      
 
Domain Number 2 Region: 13-85
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.000000654
Family CRAL/TRIO N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084RWN6
Sequence length 337
Comment (tr|A0A084RWN6|A0A084RWN6_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA80621.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_07532 OC=Stachybotrys.
Sequence
MQPVQSGYSGICLSDEEQAQLKSLVEQCQQLGLTERPDALGKGDCDYGLSDEITLLRFLQ
GRSFDVPGTIKQLQAARAIRNSVNVVAAYDTISVDTFEKTRYIYPHWTGRRDKAGYPLCI
FDLDRLDQAALKQYGKAAESGVNLDSLIFHDYLTRFVLPLCSVARDRPNPESTVTSAVYL
IDISKVTLTHGWSLRNYAQGVSTLLATCYPEVIHQIYALNVSPLFRKIWGILSKWCDPRT
AAKLIMVPAAEVDSTLQSFIDIDSIPAQFGGKLDFKHGMPVNLDEGLVKALNWNVATPGT
VPIGPLKWSTDEDGEMVVLATGVVKDQQRQEVVATTA
Download sequence
Identical sequences A0A084RWN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]