SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084RY66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084RY66
Domain Number 1 Region: 226-279
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000051
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084RY66
Sequence length 414
Comment (tr|A0A084RY66|A0A084RY66_STACH) Uncharacterized protein {ECO:0000313|EMBL:KFA81151.1} KW=Complete proteome; Reference proteome OX=1283842 OS=Stachybotrys chartarum IBT 40288. GN=S40288_01039 OC=Stachybotrys.
Sequence
MSSTLSQLAHEFAFLGDVKTARNLASLLLSEYATDWQQSQFRFLKLAFAAADEWPDQIAL
ADRDEDSLNCIRPEVEPFAGPEYEATFLLLFPRAGGLGDALSIAIDIAAEHGSSGEDLEH
VENVQRLLSIIAENLLNSKIPTRSLVQHRNVWPILCAGALVRTLRIDATKLKHFADTVLD
TFIERLKKGRRPLKTASKPIGELLSIIEQNNKTKGMTFYEECDVDIPEVFHVLPGATDTQ
LGDLETSLGVSLLDDYKEFLKHSNGFGDMFNGYPDGLFPLTRAMGRKWDDWRRYNKALLL
GYKDVDDIWFLPPSETKSTLDAYGEAMNHPQVPTEVKAITKKLVISRYGSWEEFMKLEWV
VMKIFDTERTAFGSFRGYLEGVVREMTEKTVEVIVEMIVEMVVEMVVDEAFRNA
Download sequence
Identical sequences A0A084RY66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]