SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084SGM9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084SGM9
Domain Number 1 Region: 5-181
Classification Level Classification E-value
Superfamily Hypothetical protein YwqG 0.0000196
Family Hypothetical protein YwqG 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084SGM9
Sequence length 199
Comment (tr|A0A084SGM9|A0A084SGM9_9DELT) Uncharacterized protein {ECO:0000313|EMBL:KFA87614.1} KW=Complete proteome OX=1406225 OS=Archangium violaceum Cb vi76. GN=Q664_47290 OC=Cystobacterineae; Archangiaceae; Archangium.
Sequence
MPLAKVGGAPEPVGPLAWPACTACGAPMRFLFQLPHVPGRLDLSPYAAVYVFQCENPDTA
CERWDPHSGANAVVAVEPGTASVEGARPTGLPYAEWNLGLAPAEEDTEALSVDVNEATDE
QLAALDRALEEAPESKVGGVAGWVNGDATPECCSEPMHFMAQLAAMPFGLAFGDNGRGYL
FRCRSNACGTPFRFTWQGA
Download sequence
Identical sequences A0A084SGM9
WP_043411980.1.11117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]