SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084SI60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084SI60
Domain Number 1 Region: 25-169
Classification Level Classification E-value
Superfamily OmpH-like 1.57e-26
Family OmpH-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084SI60
Sequence length 188
Comment (tr|A0A084SI60|A0A084SI60_9DELT) Membrane protein {ECO:0000313|EMBL:KFA88145.1} KW=Complete proteome OX=1406225 OS=Archangium violaceum Cb vi76. GN=Q664_42930 OC=Cystobacterineae; Archangiaceae; Archangium.
Sequence
MSLRSKLSVLALSLSLAVPTLAAAQELKVGYVDYQRVLVEVADGKAAKNRLQKWVEGREK
EIAQQQQALLKEKETLEKQASAMSEEVRAQKAADFQKKYLELMQKFEKSRAEIAERERKE
MEPIIGKIDEVIAGIAKRENLGMVFEKRDSGLVYAMSQYDLTNEVIRSYNSSSAKPKDAP
VAKDAPKK
Download sequence
Identical sequences A0A084SI60
WP_043409628.1.11117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]