SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084VDA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084VDA4
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.23e-40
Family Calponin-homology domain, CH-domain 0.00000414
Further Details:      
 
Domain Number 2 Region: 193-251
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000929
Family EB1 dimerisation domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084VDA4
Sequence length 251
Comment (tr|A0A084VDA4|A0A084VDA4_ANOSI) AGAP005829-PA-like protein {ECO:0000313|EMBL:KFB35948.1} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00002906 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MAVNVHFTGQTTDNLSRIELLAWINRTLLSDFKKVEELCTGAAYCQLMDVLFPGCIPTKR
VKYCTNVEHDFLSNLRMFQNALVQQKVDRSVPIERLAKGRFQDNFEFLQWFKKFFDANYD
GKEYDPQAARNHVPMGYGTPNTLRPSQKLNTGSSGGSGAAMKRANSNGSTSRLQAAGKGG
KNPVNEQKAWEKISTLASNIDDLTIKIQDAEISREYYYKKLVLIEKLINENPEDGQDAFC
CKVKEIMYATE
Download sequence
Identical sequences A0A084VDA4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]