SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084VNC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084VNC0
Domain Number 1 Region: 28-69
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.000000000000196
Family Chemosensory protein Csp2 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084VNC0
Sequence length 83
Comment (tr|A0A084VNC0|A0A084VNC0_ANOSI) AGAP008058-PA-like protein {ECO:0000313|EMBL:KFB39464.1} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00006957 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MRKVWLLASAVLAFLNFVKSQEVARTLYSARYDNLDIDTILGSNRLVSNYVDCLLSRKPC
PPEGKDLKPGRCGFFHWLSYVKL
Download sequence
Identical sequences A0A084VNC0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]