SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084VSX0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084VSX0
Domain Number 1 Region: 12-218
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 2.88e-73
Family Fibrinogen C-terminal domain-like 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084VSX0
Sequence length 221
Comment (tr|A0A084VSX0|A0A084VSX0_ANOSI) AGAP011225-PA-like protein {ECO:0000313|EMBL:KFB41064.1} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00008518 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MMRNELKNLTNFILPLSSCRQAPMKLSGKYVIQAEENKFGVLCEQTSFGGGWTVIQHRFD
GSTDFYRNWTEYRNGFGNLDGEFWLGLEYVYQIMKNRPHELIVELKDFEGTYKYARYREF
GIGDESEAYALKKLGKYAGTVGDSFAGNKGRKFSTYDRDHTLRKCAVKQHSGWWHDNCSN
ANLNGRYEKKDGDMGSIIWIRFKGGNHGLAYSRMMIREIIE
Download sequence
Identical sequences A0A084VSX0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]