SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084W6S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084W6S2
Domain Number 1 Region: 300-347
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000549
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084W6S2
Sequence length 362
Comment (tr|A0A084W6S2|A0A084W6S2_ANOSI) Uncharacterized protein {ECO:0000313|EMBL:KFB45916.1, ECO:0000313|VectorBase:ASIC013879-PA} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00013879 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MHHKLVLRLAIVVIVAVSAASAAASEGTVFTDESCRQSEALVFYRIKLVTSWSKKLFPKH
YPEFRPPPHWSMTFGQTHNDSFRLFEMKQPASVSVATFAETGQVGSLEDSLAQQQDVLFD
EFRLPKIRKGKGESEATFFVDGPHPSVSFMTKIVPSPDWFVGLDSFSLCSRGRWMEKVTV
PLHPLDAGTSSGLTFTSPKWPTNPRGVIERITARYPLHFASSFFYPEIKHLPPIAHVTFT
KIKEYSNRNNVHKKVKKLKHKQRTKLLKRLSQETERRAEANAEAIQGLNAVRDESVTGSD
CRVTAWSPWSPCSKTCGLGKQNRSRSVLQIQRAGGRECPPLIETQWCGSARQCSVIDNYF
RW
Download sequence
Identical sequences A0A084W6S2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]