SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084WAJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084WAJ5
Domain Number 1 Region: 15-96
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.58e-31
Family PB1 domain 0.00023
Further Details:      
 
Domain Number 2 Region: 127-248
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-23
Family PDZ domain 0.00000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084WAJ5
Sequence length 314
Comment (tr|A0A084WAJ5|A0A084WAJ5_ANOSI) AGAP010494-PA-like protein {ECO:0000313|EMBL:KFB47239.1} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00015340 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MSKSKTAHPKLDSDRVEIKSKFDAEFRRWSVKRSEQHSFEEFQSLIERLHKLDRSQLLVS
YIDPRDNDLLPINNDDNFGRALTTARPLLRVIIQKKGDSLEERTGYGTIRPRNLISSILG
QTPVKPKGLAISNPHDFRQVSAIIDVDIVPETCRRVRLLKHGSDKPLGFYIRDGTSVRVT
ANGLEKLPGIFISRLVPGGLAESTGLLAVNDEVLEVNGIEVLGKTLDQVTDMMVANSSNL
IITVKPANQRTLAPPRRGSFSRNSQLSGGSHQSQQTTGSDDNDQDDQDEVVDLIEPVTLE
ESNLISQKDGVLHL
Download sequence
Identical sequences A0A084WAJ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]