SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084WBS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084WBS1
Domain Number 1 Region: 2550-2632
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-18
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1580-1637
Classification Level Classification E-value
Superfamily BPTI-like 6.81e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0029
Further Details:      
 
Domain Number 3 Region: 2316-2399
Classification Level Classification E-value
Superfamily Immunoglobulin 1.55e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 1760-1815
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 5 Region: 1641-1697
Classification Level Classification E-value
Superfamily BPTI-like 7.24e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 6 Region: 1701-1758
Classification Level Classification E-value
Superfamily BPTI-like 7.52e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 7 Region: 2047-2101
Classification Level Classification E-value
Superfamily BPTI-like 1.29e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 8 Region: 1519-1578
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0016
Further Details:      
 
Domain Number 9 Region: 1849-1908
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000383
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0068
Further Details:      
 
Domain Number 10 Region: 1984-2042
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000752
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 11 Region: 2412-2493
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000268
Family I set domains 0.038
Further Details:      
 
Domain Number 12 Region: 2122-2162
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000497
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0086
Further Details:      
 
Domain Number 13 Region: 1907-1968
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000121
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0057
Further Details:      
 
Domain Number 14 Region: 490-548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.007
Further Details:      
 
Domain Number 15 Region: 367-425
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000602
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 16 Region: 87-138
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 17 Region: 608-662
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000968
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 18 Region: 2243-2286
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 19 Region: 425-486
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000419
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 20 Region: 666-711
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000103
Family TSP-1 type 1 repeat 0.0072
Further Details:      
 
Domain Number 21 Region: 553-605
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000837
Family TSP-1 type 1 repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A084WBS1
Sequence length 2683
Comment (tr|A0A084WBS1|A0A084WBS1_ANOSI) Papilin {ECO:0000313|EMBL:KFB47665.1, ECO:0000313|VectorBase:ASIC015709-PA} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00015709 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MAIAFAWVFFAQGHHHIQQRSPLIACPSRVGSSGGGTHLGESDSRVNGGFHFFPPQFGAR
HKRQHSGSLYQPESFIIPGGEGRPGERWSAWGPPSECSRTCGGGVAYQERECLEQSSNGT
QACTGGRRKYFSCNTQDCQEREKDFRKQQCSEFNDVPFEGHRYQWIPYTRAPNPCELNCM
PVGERFYYRHRAKVTDGTRCNEESFDVCVDGTCQPVGCDMMLGSQAKEDKCRICRGDGTS
CKTASGLLDANNLQVGYNDLLLIPSGATNVIVSERAPSNNYLAIRNLTGFYHLNGNYRID
FPRTLHFAGCDWHYERRPQGFAAPDRLTCLGPTTESVYLVLLAQDKNVGVNYEYSVPLKS
APVDEPDSYSWMYNAFEPCPVTCGGGVQTRKVTCNSKSSLKEVDEGLCNLAEKPETTQKC
GQQSCPPRWLEGPWSNCSKPCGTEGKQTREVYCERVSADGTTKKIEDDVCLEQVGNKPAT
ERACNEGIICPEWYTGKWSPCNKLCGEGERTRKVTCFRKEGGRITVLDDDQCITEKPAVS
EKCMLRPCEGVDYVTSSWTGCDECGATVETRTVHCASKSGTIYDMKFCSNRELPELRREC
KLTPCEYQWYTSQWSKCSAVCGKGVQTRTVVCGVFDGQSLKRADDDYKCVADQKPPKELV
CRTVADCDKSCGGGAKSRKVLCLSNGTVVPETNCDVDKIQLSTEGCNAHACTGDEVIPVN
VTSKQPTTEDDYDEDEECEEESDDVETTTEGQAGVRMVTDDTSLAEGVELGASGATTETS
FETDEVMMSDTTGFDSGATSPEDAMTDKVTVEGSGDASSTFDESEGSGDGAGPTTLFSVS
KASDSDASVTDASATKPSVSGASSASGEPVATTESVSSASSTELGARSSVEASAESSTES
NAALGSSSASSESVSMSKESVETTTDSVVTTTDSSATTAAMSESSTEQTTNQPDSTTDAS
VSSTTVDTESSTVDVAATTNVPSSDVASTDVATTDVASTDVASTDAATTDVPATTDSVQL
SSTVASDVASTTSKDDSATTVESSTDTSKKVDGSESTEASASELPASTTSVPAASSDSSA
TEESVTGASTDASATSATEMPSAMGSTEDFTGSTVTEASPEETTFDIWASTTGATDMDTD
DGYNSTPYTLTSVIAKEQKTRKCKPRPKVPLCAKSTHGCCPDGKTKATGPFLEGCALPTT
CKETKHGCCPDGLSPATGPKNKGCPKPECAETLFGCCPDKTTPAEGNDFEGCPVETTTVA
GCVLSKHGCCADGVAEAKGPNFKGCPGVKDDEEETSTVEPSSTDKTTDGSEPAKVDGCAG
SAHGCCPDNVTTATGPAGEGCVPCSKEPFGCCPDGKTPAHGYNQEGCCLGSPYGCCPDNF
VPARGPNLEGCECQYSPYGCCPDNKTSASGPENQGCGCRYAKHGCCPDMETDASGPGYEG
CPCHAHQFGCCPDGVTAAKGPHNQGCHCSHSEFQCCSDGKTAAQGPNGTGCTCADSKYGC
CPDGVSEAQGSKFEGCAVVPVSPQKACALPKDKGPCHNYTVKHFFDVEYGGCGRFWYGGC
DGNNNRFDSPEECKNVCETPTGKDVCQLPKITGPCTGHYNMWYYDEERNQCAQFTYGGCL
GNANRFEKLEDCKATCAVDDSKPPCEQPMEPGPCNGTFERWYYDKDSDVCRPFYYGGCRG
NRNNYPSEASCGYHCKKPGVHKPSCSQPLDAGNCEAQQARWYFASASNKCMPFYFTGCGG
NENHFVSRDQCESQCPPKVEKDTCHLPAEIGECQNYTAHWYFDTKEQRCRQFYYGGCGGN
GNNFADEQSCISRCADDGAKGREEPPPAAKPVEPEAPPPPSQQPSGQFERSHCQLPMDNG
DRNCTTYVARYFYNASAGTCEAFTYTSCGGNQNNFETQEGCEQACGDVCREEKAEGRCSE
SVPRFYYDARVHACYAFNYSGCEGNGNRCGGNQNNFETQEGCEQACGGSPIDVDLRGPTE
ERPSNGSRCEERPDYGTGRGEPVILFYYNSEQRSCEQFWYSGEGGNGNRYGTEEECQRVC
GVYRGVDVCREEKAEGRCSESVPRFYYDARVHACYAFNYSGCGGNGNRFGSAEECEQTCV
QRRQPESRVDPSGNRCRVRESGKRRMRWYYDVERETCFAFRFAGCGGNRNNFPSYDHCRT
YCNIESNEVNPCEQYENECRQLQCQYGIAKSYEASNGCERCQCNDPCASQYCPEGSQCVV
DVQGSGTVDGSGSEFVGVCRSANKPGECPPLANATQCSTDCYSDADCRGNNKCCRAGCAQ
ICISPVERPRPDDRRPVVPGVPGPVVLEQVPQEELDIKSEEGGVATLRCFATGFPPPSIR
WRKGEIMLNTNQGRYVLSSTGDLQIVQLHRTDSGTYVCIADNGIGEPVLREVELTVRDPI
PRDAYILGNLNDSQTVELDGPATLRCPAGGYPKPIVSWWRETFMMPLSMVNRDYSLHFMR
VRLQDLGPYVCQAYSGAGKGISRTVTLQAYGPATVVSPVDEKYLKYIVDGPMRPAPGVVR
PPVRPRPPVTQRPPSVSRPPVAVTVGLYFPQGQNPKPNSNFSINCTVDGYPRPTVNWFKD
DQMLVPTDRIHISDAHVLTVTGAIPSDSGRYKCLARNEQSEAFQEKSLSVEGVYVPPECT
DNQLLAKCDLIVAGQFCNHKYYAKFCCRSCTLAGQINVSPRYR
Download sequence
Identical sequences A0A084WBS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]