SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084WR18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084WR18
Domain Number 1 Region: 362-495
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.49e-41
Family Regulator of G-protein signaling, RGS 0.0000285
Further Details:      
 
Domain Number 2 Region: 77-178
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-27
Family DEP domain 0.016
Further Details:      
 
Domain Number 3 Region: 292-351
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 0.00000000000000419
Family Transducin (heterotrimeric G protein), gamma chain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A084WR18
Sequence length 514
Comment (tr|A0A084WR18|A0A084WR18_ANOSI) AGAP003718-PA-like protein {ECO:0000313|EMBL:KFB52662.1} KW=Complete proteome; Reference proteome OX=74873 OS=Anopheles sinensis (Mosquito). GN=ZHAS_00020916 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MVTKKSVDIEKEKLAKNMYSSSSSAGTGIPAKASGTGAGSGSSGTAVVSFSAGTMANSGS
SHMAQQILPHGGQDAPNILVYKKMEAIVERMQTEGTGVSVRTVKAFMSKVPSVFTGADLI
QWIMANLTVDDISEALHLAHLLASHGYLFPIDDHQLTVRNDGTFYRFQTPYFWPSNFWEP
ENTDYAIYLCKRTMQNKTRLELADYEAENLAKLQKMFSRKWEFIFMQAEAQSKVDKKRDK
LERKVLDSQERAFWDVHRPMPGCVNTTEMDIKKAYRKGASSLGSGSAGTAAHSNPAETMA
KTITLLKQKLDRRTIKVSKVAESYISYYEQYSEFDYFLSAPDHPNPWHTDNTEFWDAEKL
GKDIPMKRVKRWGFSLRELLNDPVGREQFTKFLDKEFSGENLKFWEAIQDMKALPQSQIK
DAAKAIWNEYLAPDAACPVNIDSKSLELAREVVKEGAAQPSRWCFDVAADHVFYLMKSDS
YSRFLRSDMYKECLNGSKKKVKSIPNLFGVKLNY
Download sequence
Identical sequences A0A084WR18

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]