SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A084YUS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A084YUS2
Domain Number 1 Region: 59-147
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.37e-20
Family TolA 0.0000706
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A084YUS2
Sequence length 147
Comment (tr|A0A084YUS2|A0A084YUS2_9GAMM) Colicin transporter {ECO:0000313|EMBL:KFB88966.1} KW=Complete proteome OX=82995 OS=Serratia grimesii. GN=CR62_24425 OC=Yersiniaceae; Serratia.
Sequence
MRKVNLGFGVSVPTLLLVIATLLLAGCSKPRSTIKSGASEDGVDALFAGLEGKTTPASGD
EVNTYIAQVRAAIQSHFQNVDAYAGKECSLRIKLAPNGMLIDVKAEGGDPVLCHAAIVAI
ANASFPKPPSPAVYRVVKNAALEFRPQ
Download sequence
Identical sequences A0A084YUS2
WP_037419532.1.16061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]