SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085BE91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085BE91
Domain Number 1 Region: 104-137
Classification Level Classification E-value
Superfamily SH3-domain 0.0000013
Family SH3-domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085BE91
Sequence length 138
Comment (tr|A0A085BE91|A0A085BE91_9FLAO) Peptide-binding protein {ECO:0000313|EMBL:KFC20786.1} KW=Complete proteome OX=421072 OS=Chryseobacterium halperniae. GN=IO89_11100 OC=Flavobacteriaceae; Chryseobacterium.
Sequence
MSLQDKYASVVSAAQSAGLSDLSVQEQDGVLYITGKAANSASKDSVWNALGAIDSSYTAT
DINIDVQVSGLAAGATLTVATDDSNLNIRQEPSTDASIVGKAAKGETVTLVEQSSDDWWK
IKTADGEEGYAYARYLKA
Download sequence
Identical sequences A0A085BE91
WP_034976339.1.23226 WP_034976339.1.3482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]