SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085BR30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085BR30
Domain Number 1 Region: 95-225
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.33e-33
Family PH0987 C-terminal domain-like 0.00026
Further Details:      
 
Domain Number 2 Region: 7-99
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 0.0000000000131
Family PH0987 N-terminal domain-like 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085BR30
Sequence length 245
Comment (tr|A0A085BR30|A0A085BR30_9RHOB) Allophanate hydrolase {ECO:0000313|EMBL:KFC24925.1} KW=Complete proteome; Reference proteome OX=1525218 OS=Sulfitobacter sp. CB2047. GN=IV89_06535 OC=Rhodobacteraceae; Sulfitobacter.
Sequence
MTDFPLIQTVGLSGVLVRFADTMSEPANRAALSFRAAVDAADWPEVTETSTSLVSTFLQI
DLVAASVDTLLDRLHDLLATRDWYTSDLPTGRTLWHVPTVYGTDLAPQLEEAAELAGLDP
DAAIAQLSQARVRVLTIGFAPGQPYMGELPQNWDIPRQQGLTKSVPAGALIVAIRQLIIF
TNASPTGWRHIGQTAFKTFRPRSDTPFALSPGDELCFPSISRAEYDKITATDETGQGGAE
TEVLA
Download sequence
Identical sequences A0A085BR30 A0A2D8T4P1
WP_005850971.1.35690 WP_005850971.1.62498 WP_005850971.1.64477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]