SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085GR17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085GR17
Domain Number 1 Region: 34-169
Classification Level Classification E-value
Superfamily Ecotin, trypsin inhibitor 4.71e-56
Family Ecotin, trypsin inhibitor 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085GR17
Sequence length 170
Comment (tr|A0A085GR17|A0A085GR17_HAFAL) Ecotin {ECO:0000256|HAMAP-Rule:MF_00706} KW=Complete proteome OX=910996 OS=Hafnia alvei ATCC 13337. GN=GHAL_3624 OC=Hafniaceae; Hafnia.
Sequence
MNKVSAVLASLLLASSAGAIAATAGANDDLSKQPLEKVAPYPQAEKGMSRQVIYLPKQEN
ENDFKVELLIGKTMDVDCNRHMMGGKLESKTLSGWGYDYLVMEKISEPASTMMACPDNTK
HSQFVTANLGDSAMQRYNSRLPIVVYVPQGVDVKYRVWQADTKIQDSVKK
Download sequence
Identical sequences A0A085GR17 A0A097R4L6 A0A0K0HRK8 A0A1B7KDJ2
WP_025797571.1.36219 WP_025797571.1.41100 WP_025797571.1.48059 WP_025797571.1.50384 WP_025797571.1.56080 WP_025797571.1.62958 WP_025797571.1.67501 WP_025797571.1.93107 WP_025797571.1.9424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]