SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085K9G5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085K9G5
Domain Number 1 Region: 6-159
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 5.49e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085K9G5
Sequence length 162
Comment (tr|A0A085K9G5|A0A085K9G5_SPHYA) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=13690 OS=Sphingobium yanoikuyae (Sphingomonas yanoikuyae). GN=IH86_04285 OC=Sphingomonadaceae; Sphingobium.
Sequence
MSGTVEVGIIMGSRSDWETMRHAAETLEALGVAHECKVVSAHRTPQRLYDYATSAAGRGL
KVIIAGAGGAAHLPGMAASMTRLPVLGVPVESKALKGMDSLLSIVQMPGGIPVGTLAIGK
PGAINAGLLAASILATHDDALAERLDAWRARQTEAVAETVED
Download sequence
Identical sequences A0A085K9G5
WP_037507036.1.27820 WP_037507036.1.2929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]