SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085LKH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LKH2
Domain Number 1 Region: 117-157
Classification Level Classification E-value
Superfamily Elafin-like 0.00000129
Family Elafin-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085LKH2
Sequence length 158
Comment (tr|A0A085LKH2|A0A085LKH2_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD45468.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_13658 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MEQHTIILAIAAVVIISIALPTEAMICPDGFSAIEHCADGFCPSGFYCYMGWCCRSRRYG
GAIGSCPTCGRPVFGMRGCPDGSAPYGTCPTGYCPFNYNCIRGVCCKAARYVKISSRGCP
KVYGPIYEGNDRCFTDQDCAGGKICCKSRYGKRCMYPL
Download sequence
Identical sequences A0A085LKH2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]