SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085LPW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LPW4
Domain Number 1 Region: 844-931
Classification Level Classification E-value
Superfamily DEATH domain 2.53e-17
Family DEATH domain, DD 0.00051
Further Details:      
 
Domain Number 2 Region: 138-228
Classification Level Classification E-value
Superfamily Immunoglobulin 6.4e-17
Family I set domains 0.053
Further Details:      
 
Domain Number 3 Region: 290-344
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000889
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 4 Region: 227-286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085LPW4
Sequence length 935
Comment (tr|A0A085LPW4|A0A085LPW4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD47010.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_12092 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
METTIGEPTENDEQSTAKPLLIETPNDAYLVRGRHQQMSVALTCKALYADHIRFKCNGLW
IPDAQHERREGIDSATGTPFVQTSVLVSRQAVERYRLSRGSDYACECYAFGASTNEMAIQ
VKSQPATVRVAYMLKDFYREPASERRPLGSLVEMPCLPPEGEPAPEVFWLKDGVEIVSRK
DPNVIVANDGSLLISSARLSDSGNYTCGARNIVNERLTAPASLHVYVNGQWSQWGEWEGV
CPTSCDVFADSRHPFAKLTRYRHCNNPVPANGGLPCPGDPKEQVDCDLSCPIDGDWSAWS
RWSECQTDCRRQRRRVCDNPAPRHGGQQCHGADRQWRTCSDLLCSAGKFFRRIGSSPDQQ
LAADKFASNGSNNVAMYAGLGAAFFAFLFAFAFIFAIMLRRRTCRRCAKDYEAAPNCPSP
PMHSCIPPPEIVSKLNNHRPACTFDPPPTLNSERSRKGLITWSQKSDSSAVYYPNSSEDN
NYATVDDSRIEYEYSADRVSLVSANPSRYTSSPASHTSNGHSILLKKHAISLFIPEGALS
QGEDIDLSLVYADECCPPLNDMQTLITPVVWFRSSRMSSSLKKPAVLSIEHSALLPSSNN
GSPPRLNDWQLSCLVSEELPYEGLVSDWTIAAVVGQETLNTDVYCQVESRLVHILLESFG
KFAIVGEPKHPNAQLVKVSGRMEKISKLSLFILFKRTKLLAFFGDGCLRVYCAADVRAAV
NWITNREHELGGRLCGLCTDIFAVNFYKDVHVRLESIGSGWTLPLDESRQLIPSAHFQCD
RPEAAHCAFKLTIVGDTSSVEQNSFKGRVRIYQKTMETGDGLLMDVDTEAWWDISDCYGN
FFPAVRLAHSIKQRLASLLDPPLENGNDWRMLAQLLAVDHYLPYFASRTSPTELILTLWE
SREQNVHGFVKLLHFLRRMKRQDACAVLSGYLNSL
Download sequence
Identical sequences A0A085LPW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]