SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085LQP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LQP6
Domain Number 1 Region: 281-494
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 9.11e-54
Family Reprolysin-like 0.00096
Further Details:      
 
Domain Number 2 Region: 588-644
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000432
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085LQP6
Sequence length 977
Comment (tr|A0A085LQP6|A0A085LQP6_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD47292.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_11802 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MRWPVQALLTAVVACGTLSFLFTCLLFWWRQDHHKELTLGHFHYQQQQEQQQQQQKRQLR
QPRAIQTGRTPIVAVDSLQRQIVLPQLLPQLSNGDRRLKRSPLLPVDSVNRSARVQDRYL
YALAAFGGTMLLNLSRMDIDSLLAPGFVVQHLMTNYTWTEEEVRPATECMYYGQVLSTNR
HPSDVGAALLNLCDGMYGTVALNDGTYFLEPLEPTGNWSSPDRRPHILYRSGPSTFHDRS
SPPPIVEPSIEKADVDARANATDNELKNKSAWSNRRKRSYSREYFVELLVVTDTRMRHYH
RHNLENYVLTLLSIVATVFRHPSLEASLSIHLVKLLIVDYENAGPRINDNAQQTLREFCR
WQHSINDPDDESANHHDVAVLLTRHDICRLPGKCDTLGLAELGTMCDPFRSCAIIEDNGL
SAAFTIAHELGHIFNVPHDDEKKCAQYMTLNKDNYHIMAPTLEFNTHPWSWSPCSTAMLS
KFLDSEMAHCMLDKPVEQKYSAMLTANPAPGLSFDANQQCQFVFGPTSSLCPYMPTCKRL
WCTTPYGHGYPSGCRTQHMPWADGTPCGSNRWCYRGDCVGIAPAHMLAVDGAWGEWKSWS
ECSRTCGGGVKRAARECDNPRPSNGGKYCVGERVRHRSCNIKDCPIDSVGFRELQCTEFN
GKPVGIYGISSDVRWVPKYNGAQFPLPVNTANRCKLYCRIVGTAAFYLLKDKVVDGTPCG
RYTEDICVDGTCRKAGCDNRLGSDLKRDDCGICGGDGTSCAKVSGAYNEIHVYGYNFVTK
LPVGASNIDIQQVAWNGKKEDDNYLALQNSKGEFILNGHFQVSVYSQEIAVLGSVIEYSG
SDSFIERLNSSRPIMEELFLHVLSVGGLNMPDVRYNYSIPKTPVHSFVAPNEFAWRNTEE
WTDCSRICQGSQDIKTECIEVEEERVVDDRYCESLKRPDRMTRACNLHCQTSNIENIQRT
LVSQMAATLWRYNSYLQ
Download sequence
Identical sequences A0A085LQP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]