SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085LRB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LRB3
Domain Number 1 Region: 989-1285
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.51e-33
Family APH phosphotransferases 0.017
Further Details:      
 
Domain Number 2 Region: 389-539
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.65e-17
Family Regulator of G-protein signaling, RGS 0.0042
Further Details:      
 
Domain Number 3 Region: 593-677
Classification Level Classification E-value
Superfamily PX domain 7.72e-17
Family PX domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085LRB3
Sequence length 1286
Comment (tr|A0A085LRB3|A0A085LRB3_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD47509.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_11603 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MEDAEDASSAVLAGGNICIFQCFNIFRVFKSGKLCALIAALLALQSFGLYGCSCIVLCTL
FFLIGCFVRLFFYVWNVRYPMLLRDFDAIDWTSEKKFILPKLKAVTFDKNAKLPCSENVE
KLINEIVDYTIRDYVTSWYSKLTNDDGFIKSVRCLFITALRVLIVGLKNVNWVTVLTHDV
IDDFATHLRLFRKAKQKYDKVVSTGSEPRPDLLEQYFFEMEYELESSFCRKRLSMSKQGE
NEFLRSLGDVLVYLLLPTKDLSPHLFRLLLRDVLAVQVIGGTVNLICDPDYICHTVATLL
FTVPLKYEDFITVLEATDDADELNGTMESLQQEIELQRSKDTGGADDSLIKQQLGSLFYL
QKLIAGRLSRLQTSDSSLDEAGDGWQDCAAMYDLSLAFVLCNHVALCSFIDYLSQTDGKT
YIDMYLTVEASEGFKNSFPHPSGRSSGDHVRANESLIISSAREVALEIYNQYFQAKSDRL
VDIDEGIKKRLQAMIRSKVHPSLWFDEAQQRAYEILENDIRFYPSFKRSAAYVKLLAELK
LLLPQDKSDETNPFSIPPTTSVLGDQADSSEVDSATVKDFVYETNIKTIGMGNEQSTIFA
VYNIEVKKFDHRGQCMKHWIVTRRYSDFYNLNCVIKRKFPQLAKISFPAKKTFNNMHHGF
LERRKRALNTYLKVRLHIANSPCRSSVAKSAPLQTLLDPALLKRCKGLENLLLEFLCRMD
YNGDGGTLVEKLNSVVDPIRSGVKFVGNAVISMPDTLIDGVCKVGDGLGKVTRTVFGIQE
LTPSQVENFGGRVAASLNYESADSIPLRILMLLVDEIFGLQEQNQWIRRRMVSFLQQLIH
AMYGSSLNRKIVEYVHWLTSEEQVTNYVKLFRNSMWPNGVLAESAPVRPQSTKARTRVVA
RTQTLSLLPDEFKLFIGNDSTTAGVCMVFEALQHECLNRRLCYVLLERLIVSVFPNRNVD
QTSLQSISRMNTSDEAELRNSLETETLTVYGQRGGGCINQGCGYMTDNGPIFVKLNRDQK
VIVQASIMFKGEFASLAALYAANCVIPIVRGALFAAEYIDGMSRLNKYAALLGKQLARLH
LHNSQLLKAQSERESWVTDRHDDFTIEPVTKFGFHETTCCGFIPMDNRWSDDWVEFFTQK
RLQAQYDKVMSDSGDRRLSELWPRVLEKIPSCFENCGEIVPCLLHGDLWSGNIKGANFGS
YGNFTAVIFDPASFYGHSEFEFGIASIFGGFNRQFYDAYYELIPKRPGFEKRLRLYALFN
YLNHWNHFGSAYRESTLREMKAIIDS
Download sequence
Identical sequences A0A085LRB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]