SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085LWX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085LWX6
Domain Number 1 Region: 514-619
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.09e-27
Family Regulator of G-protein signaling, RGS 0.00033
Further Details:      
 
Domain Number 2 Region: 10-93
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-16
Family PDZ domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085LWX6
Sequence length 622
Comment (tr|A0A085LWX6|A0A085LWX6_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD49472.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_09657 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MNKMRKAEQPEGQRTVLLKRGSKGFGFSLAEQYPSCLSAVHAEGAASLAGLRVGDIVVAL
NGADVQKASHRRIVDIVARSGSTLEITVQTPQSKSLCSLIENPNARLRAGRFANLVTPIS
DKLGHLPDRIGFAGSVRPEVALSMPGLRIHQDRNPSRGRGCTVLQSSMVAHAGGDSSSDS
SFMERDLDLIFQVVLVYIGSVTVPASQRSRRKVLRLALHSLKAQKVRVRTVLMKAYEDQL
VVTNSKGALINRLKNSNVAFVAACPENKQYFCVTMLHQDDDSISGRGGGQSSPSSSVDES
AISHVFAVDPELHSHSYHYLYAKRFGIKCTRAPTIDQTGALLGGIHASTFPAYSSCLEFP
DVSVAVLQSLSSLVEHSKSTESQRIVTDSGDRPPIVEGRSRKFIAQRSFPWSSPCTSSCP
TDAEERQLRKEEQAQCSQGADSLRRSSLLVLSDGLTMDSANGRTPSGGEPSNSGNLLLRK
LCSERVRRPKNKTLSLCQEPAEKLTNLRLSNGESPHDRWTDDFEMLLHDPERLSVFAKFL
RKEYSEENIEFWMDCEEYKRAASSQDRQMLGKHLYDCYFSPNAHKPVNVDSEARQSVKAG
IEAGNFTESLFDKAQLQVSFHN
Download sequence
Identical sequences A0A085LWX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]