SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085MI60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085MI60
Domain Number 1 Region: 332-380
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000916
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 208-267
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 3 Region: 387-447
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000000139
Family Antifungal peptide scarabaecin 0.065
Further Details:      
 
Domain Number 4 Region: 272-324
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000746
Family TSP-1 type 1 repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 160-209
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000327
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 453-508
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000471
Family Tachycitin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085MI60
Sequence length 513
Comment (tr|A0A085MI60|A0A085MI60_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD56906.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_02163 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MLCLKVSLLLLLFFHENFLAQGDELTYNPADIEEEEEEKGGSNPWKTKTKKWETTESTTT
KKAPTEGKPGTATTTKALTEGKPKTTTTTKAPTEGKPKTTTTKGKPSKTTTSWKPPKTTT
TKWKPSKTTTTTEATTTSAIDWPTDCTTNQSIPTEPPQRNVTCIWGSWGPCSATCNYGIW
TRSLVSLTNPEVPCTPPMTQKDGCFVAPCPMDCVVSPNWQCWSPCSAACGGGYRYRSRQV
VTPPLFGGAACNQSDIDQQEACNTSPCAYECRTTGEWSSWSSCSSTCGGGIQERSIAYKE
GLLAMRSGPNTTCTKTAQYRFCNLSCCSTSYNCLQSDWTSWSPCSASCGSGIQYRSRRIL
VPSIGNGTSCGPTYEKQKCNTLSCTESSLSMLCSRRRNTFIPFGRCASDYIYCTPGGQAV
FNTCPQDKAFSTSYGICVNKWMIADCAKESRASDCVGRTNGLYPLCPCCSQYLLCWEGVS
TRRSCRSNEAFETSPFGRCVDRSSSPACMRKWK
Download sequence
Identical sequences A0A085MI60

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]