SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085MKU0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085MKU0
Domain Number 1 Region: 777-822
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000589
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 236-281
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000262
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 3 Region: 583-625
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 4 Region: 674-727
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 729-778
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 328-381
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 629-673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.00096
Further Details:      
 
Domain Number 8 Region: 896-940
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000123
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 9 Region: 285-329
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000115
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 826-873
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000106
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085MKU0
Sequence length 967
Comment (tr|A0A085MKU0|A0A085MKU0_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD57836.1} KW=Complete proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_01069 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MATLLAYLNGVHSRKAPFAYTTNQRKVILLSRRMLVYHIAGTYMLLTFVPAVGAEVRCIE
EQSNSVVVGSTPTHIFSAEAPHVCVSACIKAKPPTCSLSAFTRRSDRENGTCFLYKESAE
KIAVKRRSLKVSKSSGAINSVYKLLQRCPNVDKNISEVAKKYIKMGGRKVLNIEGKAGWG
MPVEVHVDDWGPWSEWSPCVEPIPVAEEIAVHNRVRMCAACGVNRVIEFETTSCDCCPEW
LPWGPWGPCSASCGTGVSIRSRLCTIPGACPGPSEDVRPCAMAPCATWTVWGPWGPCVGA
CGIGHRERIRHCEGVGSCPGPASESMVCHEVPPCCSQWSPLSPCSVTCGRGIQTRFRRCE
PVGHPMIPHLEESIPCDMGPCGHWVPCMTWVEETGPVIDEECMARKNVGCVKEEPNSVID
GEVPDETMEVEAAHMCIATCMLARAMPCSVALFTRKSLYENGTCNLYKKEADKMRIRQIR
QGPSGSMSSVFKYSRDCPPINKTLVDAQKTRKISKVEGRAGYGAPVQIYSNGWGPWSAWS
SCVSTVSCGRTWTVQNRIRICSVCGQSRAIEVESRPCDCCQAEWLAWGAWSPCSATCGEG
TSARYRQCQTPGACTGEAQESRTCNAGPCAQWGPWNDWSACPVTCGTGGQRERMRQCFGG
GQCVGAAREYTPCDNLPPCCTQWSAWGACSVTCGEGTQTRTRECGSDPSGSYNAELVETR
PCSNRPCAYWLPWTEWTPCSSSCGPGTSFRQRECQGGVAEVDCPGSAQESRQCDGGPCPM
WSAWNAWTPCSVTCGTGERTRQRQCMHGTDCPGESFQSKPCYLCDCPSWTQWNPWEDCDP
STGQQTRIRYCCGSPDGSSSACPGEAQESQPCTPQLESGTGVQSPSPYDMRKSALQFTWT
EWSACSVTCGQGIQTRNGMCQGTTRCTPKREERKCETAPCGGYADKRFHQFYASRRRDRV
SKGGTGN
Download sequence
Identical sequences A0A085MKU0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]