SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085MNE4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085MNE4
Domain Number 1 Region: 2-94
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.66e-33
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 121-160,227-279
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 5.49e-18
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 152-224
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 6.8e-17
Family DnaJ/Hsp40 cysteine-rich domain 0.0003
Further Details:      
 
Domain Number 4 Region: 272-353
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 9.94e-17
Family HSP40/DnaJ peptide-binding domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A085MNE4
Sequence length 420
Comment (tr|A0A085MNE4|A0A085MNE4_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD58740.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M513_00433 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MVKETKFYEILGVSPNCSEADLKKAYRKLALKYHPDKNPSEGERFKLISQAYEVLSDAEK
RKIYDEGGEEAIKTGGAHGGFEFSSPMDLFDMFFGKLRCPKRISEHTESLARSGGRRGRQ
RERRGKDVIHQLNVSLKEMYTGSVRKLAIHKNVVCPKCDGKGSKDGLTQKCSQCNGAGVQ
VRSHYISRNMLQQTQTVCHTCEGSGEYINPADRCPQCSGAKIIKQRKVIEVEIEKGVHDG
KKIVFSEEGDQLPGVRPGDVIIILDEQEHPIYHRKGVHLFVKVAIMLSEALCGMEKTLET
LDGRKLQLSTDPGDIINHGDYRTVLGEGMPYYGNPVEKGNLIIEFVVQFPPPKSLHPQQL
AKLEALLPPKLEFVPPAGAKEAVLLRVNSRSQQKMGRSRSADSDEEDMNSGPRTMQCQPQ
Download sequence
Identical sequences A0A085MNE4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]