SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085MZE5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085MZE5
Domain Number 1 Region: 190-324
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.62e-24
Family Regulator of G-protein signaling, RGS 0.00016
Further Details:      
 
Domain Number 2 Region: 925-1005
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.2e-20
Family DIX domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A085MZE5
Sequence length 1007
Comment (tr|A0A085MZE5|A0A085MZE5_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD62591.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M514_01108 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
GRTCTSDCAPAAAVRSKGFDGARWRSISAIRGSVFDCFTFIGGRRTPHFITIFISTRSRC
SNLRARYAPRLKPSPAISMSAAGKLDEEMTAEFSPLPPRPPAVGASFDSTASGARSHSSD
MKVSDPSRSNKYNSRAQSPLLVTSRKSSRAGSLSDFPREGSEEAPLGYEVCDDDDDDGDD
DASPYSERATPPYMRWAVDLQNVLEDFEGLQLFKKFLNNEGCGNELDFWYACKGLKQYSE
KEKPLIERVAHMIHQNYVRPQGEFSLTCIRSETRVEIQKRFVAKEVSQTMFNAAQLEVES
FLRIKHAAFVESDMYISYLQVIQTGGWDSPKCYSNESRSNSSSNSSSDAQRPSSTLLPTV
HEEVEIEVEQHQQQTASSKPTTNVESSSNSKPKKADESGKAASGCKECTAPPCSLLTTST
SITTTAVSPSVLVPSEMVAIPVRKKSSGQSNFGNRLTAGALVATLEQRMAYSACRSSRSG
VPPNPYHTKYVPYLPTSAQDSELQSMSSDAATESSLSNSRYRHKERRIIRQHIEHNRDPI
ASQIFIPAALARSILQRTQREVIARDMMDEEFKVQVIEKLEHVRRERETYEKLNESLQRL
SEPENNSNSHRAAVEKFCKVEKSFRAAPEDAEAILDDYYTRVGWKDSPKHSPMRSPGFAF
GSRRKSPVSKSPDRRGIRIMTTSYPLPYAVAQTLPMHPAAVSMLRTSSSSQEAHPLIQVP
PIPAHLMSKHRSSGHGNPVSSHRSSRAESGGVPSGGAQQQVQRGGQSSTSSFVKNSKQFM
RFPIMASDTSGISSGTSSDPSLVSAKIPSVASYNKPVTEQWILEERPAQSPYDSGERHRS
RVSSSGVVSFGGKVYKSSSHKGSNSESLQRSSNTEKSSRLHKAGASVNEGSVGQGGNSRK
TAGTRANVSAPPMSSPASQSSVSHEYISVGYFLPNESTPYVTRFAGRQITLKQFKQLIPR
KGNFRYFFQCASDELGTGMIQKEVTDESEVLPIWEGNKIVAKIVCVD
Download sequence
Identical sequences A0A085MZE5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]