SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A085N5W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A085N5W7
Domain Number 1 Region: 175-203
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000183
Family Somatomedin B domain 0.0038
Further Details:      
 
Domain Number 2 Region: 200-264
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000667
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A085N5W7
Sequence length 406
Comment (tr|A0A085N5W7|A0A085N5W7_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KFD64863.1} KW=Complete proteome; Reference proteome OX=68888 OS=Trichuris suis (pig whipworm). GN=M514_01677 OC=Trichinellida; Trichuridae; Trichuris.
Sequence
MRLRQLLLVLFLSLAIRPCRGGCAEFRICCRGRNTTCVAYDNILINVLPNGQAAGQTGKD
QYVIVGLKNGAKTQLPSYEISVKTVKRQTGQEISFGSGSGFVPFTGGVFQVSLNENENDE
HLQHLYEEEEPTELTTDQPKLYDEDNVQEGQSTPQALDMTTSNEPPASLWPSVMQRSNLC
YCDEACVRLKDCCSDYISVCPVVDCQVSAWSHWSPCQSGSNHKSNALAEPHCGLGTSVRH
REVVKAPQHGGASCPVLDQQRACYEDTAEHCHKTLSEIALILPYKYSSARSLSKKSKIYY
DLPKVLFKLKAAKSYCVIFEITWTSRHCSNQNDVPTEGQTVCVQCDPRTQISQAEGRCIG
HGVDEKKSRWNLLFTKHCYGQWTRVSRSDGCQCDHAYPDLPRYTFV
Download sequence
Identical sequences A0A085N5W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]